PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01533.1.g00110.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 267aa    MW: 29162.3 Da    PI: 4.5118
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01533.1.g00110.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.31.5e-194598356
                                  --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                                  k++++++eq+++Le+ Fe ++++  e++++LA+ lgL+ rqV vWFqNrRa++k
  Zpz_sc01533.1.g00110.1.am.mk 45 KKRRLSAEQVRTLERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRARWK 98
                                  45689************************************************9 PP

2HD-ZIP_I/II134.92.7e-4345136293
                   HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLek 82 
                                   kkrrls+eqv++LE+sFe e+kLeperK++lar+LglqprqvavWFqnrRAR+ktkqlE+dy+aL+++yd+l++++++L++
  Zpz_sc01533.1.g00110.1.am.mk  45 KKRRLSAEQVRTLERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRARWKTKQLERDYAALRHSYDTLRHDHDALRR 125
                                   9******************************************************************************** PP

                   HD-ZIP_I/II  83 eveeLreelke 93 
                                   ++++L +e+ke
  Zpz_sc01533.1.g00110.1.am.mk 126 DKDALLAEIKE 136
                                   ******99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.55E-2035102IPR009057Homeodomain-like
SMARTSM003892.4E-1843104IPR001356Homeobox domain
PROSITE profilePS5007117.0745100IPR001356Homeobox domain
CDDcd000861.20E-1845101No hitNo description
PfamPF000467.1E-174598IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.3E-2047107IPR009057Homeodomain-like
PRINTSPR000319.0E-67180IPR000047Helix-turn-helix motif
PROSITE patternPS0002707598IPR017970Homeobox, conserved site
PRINTSPR000319.0E-68096IPR000047Helix-turn-helix motif
PfamPF021832.8E-17100141IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009637Biological Processresponse to blue light
GO:0030308Biological Processnegative regulation of cell growth
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048573Biological Processphotoperiodism, flowering
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MKRSRGGSPS LLSMTNPDDD GYDGVGMEAE GDAEEEMMVC GGGGKKRRLS AEQVRTLERS  60
FEVENKLEPE RKARLARDLG LQPRQVAVWF QNRRARWKTK QLERDYAALR HSYDTLRHDH  120
DALRRDKDAL LAEIKELKAK LGDEEAAASF TLVKAEPATS DGPPPTGAGS SESDSSAVLN  180
DADQAGATPP TEAPVPEIQP GTLVGTATAL AGTAPARQGE VFFHGSFLKA EEDETGFLDD  240
DEPCGGFFAV EQPPPMAWWT EPIEHWN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16975ERKARLA
292100RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00051PBMTransfer from AT4G40060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0342571e-167BT034257.1 Zea mays full-length cDNA clone ZM_BFc0009H14 mRNA, complete cds.
GenBankBT0390621e-167BT039062.1 Zea mays full-length cDNA clone ZM_BFb0367N11 mRNA, complete cds.
GenBankBT0553741e-167BT055374.1 Zea mays full-length cDNA clone ZM_BFb0091J03 mRNA, complete cds.
GenBankEU9482461e-167EU948246.1 Zea mays clone 371798 mRNA sequence.
GenBankJX4699291e-167JX469929.1 Zea mays subsp. mays clone UT3187 HB-type transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957072.11e-153PREDICTED: homeobox-leucine zipper protein HOX4-like
SwissprotQ6K4981e-127HOX4_ORYSJ; Homeobox-leucine zipper protein HOX4
SwissprotQ9XH371e-127HOX4_ORYSI; Homeobox-leucine zipper protein HOX4
TrEMBLK3ZW401e-153K3ZW40_SETIT; Uncharacterized protein
STRINGSi030822m1e-152(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30093482
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.13e-47homeobox protein 16